4. Complete this table. Types of mutation: transition, transversion, missense, nonsense, silent CODE after Original CODE MEANING MEANING Type of mutation mutation AUA Transition GAG GGG C Silent UAC UAA GAU GAG UCU UUU
Q: 1- Habitat YY has the greatest species richness. ( choose true or false) 2- The alpha diversity in ...
A: Introduction: Species is defined as a group of living organisms that have similar characteristics ge...
Q: With the help of a schematic diagram describe the haplo-diptontic life cycle pattern in plants. 1.
A: The production of a sexually reproducing plant alternates between a haploid and a diploid phase of p...
Q: Define parfocal in microscope
A: Size of Microbes is too much small that it is impossible to see as such . So , in such case Microsco...
Q: osmolarities and the water potential components
A: Water potential is the difference in potential energy between a given water sample and pure water ....
Q: Which of the following claims is NOT FDA approved? A. Reduce hypertension B.Fat free C.Low potass...
A: FDA means Food and Drug Administration. The products which show relevancy and efficiency, it is term...
Q: 3. Explain the differences between a point mutation and a frameshift mutation.
A: Mutation - A mutation is the condition during which there is any damage to the gene / DNA as a resul...
Q: The stomach is where proteins start being broken down. A. True B. False
A: Stomach The stomach is where proteins start being broken down. This is the given statement Explanati...
Q: Which of the following do sodium and potassium NOT have in common? A. Rich sources of both include f...
A: Minerals are those trace elements we get from foods that are essential for the normal growth and dev...
Q: Facilitated diffusion across a biological membrane of intestinal cells requires the presence of Trig...
A: The process of passive transport (no energy required) by which molecules or ions of living cell move...
Q: The study of the cell, its types, structure, functions, and its organelles are known as Biology Cell...
A: Cell organelles are the structures present in cell which carry out particular functions.
Q: A dihybrid cross involves A. two genetically different individuals B. two individuals that are heter...
A: Since you've asked multiple questions, we're only answering the first three for you. If you want any...
Q: Please help with these as they are part of 1 question and I am so confused. I really need help like ...
A: The food web is made up of all food chains within a single ecosystem. All organisms in the ecosystem...
Q: Lipid bilayers are said to behave like two-dimensional fluids. What does this mean?
A: The lipid bilayer (or phospholipid bilayer) is a thin polar membrane made of two layers of lipid mol...
Q: ACTIVITY NO.3 Given the data set below: a) Construct a frequency distribution table, b) show the Lea...
A: Answer :: Given data 23,34,32,21,9,35,33,22,41,40, 43,8,25,46,43,50,54,52,8,11, 12,13,15,20,29 The f...
Q: Please help with these as they are part of 1 question and I am so confused. I really need help like ...
A: Character displacement is an evolutionary change that occurs when two similar species inhabit the sa...
Q: The study of the cell, its types, structure, functions, and its organelles are known as Biology O Ce...
A: Solution : The study of cell structure and function is known as cytology. Cytology is also known as ...
Q: Fill-in the table below with their distinguishing reproductive features and examples.
A: Fungi is a group of eukaryotic organism that includes yeast and molds.
Q: Which stage of a cell's life is the longest? In other words, which stage does a cell spend the most ...
A: Cell division is a metabolic process takes place in eukaryotes in which splitting of parent cell re...
Q: How will the feedback mechanism in the menstrual cycle responds if there is a high level of Estrogen...
A: A feedback mechanism or feedback loop is a physiological regulation system in a living body that wor...
Q: Which of the following statements is TRUE? A. Water and electrolytes move across the cell membranes ...
A:
Q: In the phylogeny below, the origin of which trait could be indicated by the letter B? A single tempo...
A: Phylogenetic tree is a branching diagram to understand the evolutionary relationships among organism...
Q: Every person must burn energy to stay alive and function. However, different people are designed to...
A: Every person must burn energy to stay alive and function. However, different people are designed to...
Q: What is the difference between hunger and appetite? A. Hunger is a physiological need to eat ; appet...
A: Answer-- D. Hunger is a physiological need to eat; appetite is a psychological desire to consume spe...
Q: In eukaryotic chromosomes, DNA wraps around_____ . a. histone proteins d. centromeres b. sister chro...
A: DNA(deoxyribonucleic acid) is a molecule comprised of two polypeptide chains that coil around each o...
Q: Mitosis: Name the Stages of Mitosis These pictures show the order of stages during mitosis. Name eac...
A: Mitosis also called as equational division is the process by which two daughter cells are formed by...
Q: Most water is lost daily via the? A. Skin B. Colon C. Kidneys D. Lungs
A: Water loss from the body: water loss through the body occurs in many ways such as urination, sweatin...
Q: Many manufacturers claim that their health care and hair care products are pH balanced or buffered. ...
A: ANSWER;- So we test their claims is Drop add acids or bases drop by drop compare with water.
Q: Spermatogenesis usually occurs during the ___________ and continues in the _________ stage in some i...
A: * spermatogenis is the process of formation of sperm from germ cells in semniferous tubules of testi...
Q: give the results, discussion and conclusion based on the images given.
A: Competition In ecological relationship the competition is the interaction between two different or ...
Q: What do TATA boxes, initiators, and CpG islands have in common? Which was the first of these to be i...
A: Transcription is the process of RNA synthesis using DNA as the template. The process requires a spec...
Q: sequence. Name each stage of mitosis, A to E. Each answer choice used once and only once. Picture A ...
A: Mitosis is the process that occurs in the somatic cells. This is an equational division in which the...
Q: 12. What is the window phase of an infection? How is this concept important for the test of HIV infe...
A: Introduction: AIDS is caused by Human Immunodeficiency Virus (HIV). It has a single stranded RNA wit...
Q: Describe three types of mutations
A: A mutation is a change in a DNA sequence. Mutations can result from mistakes happened during DNA rep...
Q: The structure of aspartame, is shown in the following diagram. Label the functional groups. H O H H,...
A: Aspartame It is an artificial non-saccharide sweetener. It is 200 times sweeter than sucrose. It is ...
Q: The information travels from one nerve cell to the next in the form of neurotransmitters antigens el...
A: Neurons are the unit of nerve impulse transmission or nervous system. These Impulses are transmitted...
Q: 15.The zone of the testicular follicle where the primary spermatocytes become secondary spermatocyte...
A: Spermatogenesis: Process of formation and maturation of sperms in testis. It includes 5 stages of de...
Q: Important: This is a multi select question. Choose all the statements that you think are correct. A)...
A: Phosphofructokinase (PFK) is an enzyme that regulates the transformation of fructose-6-phosphate (F6...
Q: 16. What is the difference between taeniasis and cysticercosis?
A: The adult tapeworm placed within the human intestine causes taeniasis, a parasitic disease.
Q: vast majority of fat digestion and absorption occurs in the? A. Liver B. Stomach C. Large intestine ...
A: Digestion is a process where large food particles break down into smaller particles due to enzymatic...
Q: Compare and contrast bacterial and eukaryotic gene expression mechanisms.
A: Crick established the central dogma of molecular biology by explaining the flow of genetic informati...
Q: Which of the following types of fat is required to be listed on the Nutrition Facts Panel by the U.S...
A: Answer- A.Trans fatty acid
Q: Match the reactions with the events. _____ glycolysis a. ATP, NADH, FADH2, _____ ferme...
A: c. NAD+ regenerated, little ATP:- fermentation a. ATP, NADH, FADH2 and CO2 form:- citric ...
Q: General properties of Sex-linked Inheritance, traits is always passed from the father to son and onl...
A: Sex-linked inheritances are also called X-linked inheritances. In this inheritance, the gene is pres...
Q: The food eaten every day should have the following characteristics EXCEPT adequacy excess balance mo...
A: Food should be adequate, with a sufficient amount of all the essential nutrients, as well as fiber a...
Q: Draw the position of the letter "e" as viewed under the Scanner, and the actual position of letter "...
A: Microscopy is a scientific study that covers utilising microscopes to examine specimens and things t...
Q: What is a pesticide? How integrated Pest Management (IPM) keep pest population low without economic ...
A:
Q: High-salt food has been clearly linked to risks in heart attack. A. True B. False
A:
Q: Q1 Human body system is a powerful machine that works all the time. To maintain the system, homeosta...
A: Introduction Hormones play important role in normal physiology in our body. They control various ph...
Q: Cell Cycle: Sequence of Events The circle represents the life cycle of a cell from its beginning to ...
A: The series of events where DNA replicates and divides into two daughter cells is called the cell cyc...
Q: Choose a syndrome or disorder caused by a mutation. Write the cause, type, and efffect of this mutat...
A: Introduction :- A syndrome is a collection of medical indications and symptoms that are related to o...
answer the table please
Step by step
Solved in 2 steps
- Identify the type of mutation shown Original Sequence: GGC TAC ATG GAA Mutated Sequence: GGC TAA TGG AA deletionK Ć Chrome File Edit View History Bookmarks. Profiles Tab Window Help Content X Biol 1406 X Content X Begin: Test X A Tutorial for X acconline.austincc.edu/ultra/courses/_891351_1/cl/outline A Unit 3 Ove X A Unit 3 Ove X ☎ D)) 33% Content Choose all the types of mutations which may result in a frameshift mutation: nucleotide insertion nucleotide substitution nucleotide deletion X G We G Trar QMutated DNA Sequence #3 T A C A C C T T A G C G A C G A C T … What’s the mRNA sequence? (Circle the change) What will be the amino acid sequence? Will there likely be effects? What type of mutation is this? ________________________________ Mutated DNA Sequence #4 T A C A C C T T G G C G A C T A C T … What’s the mRNA sequence? (Circle the change) What will be the amino acid sequence? Will there likely be effects? What type of mutation is this? ______________________________
- Identify the type of mutation shown Original Sequence: GGC TAC ATG GAA Mutated Sequence: GGC TAA TGG AA15/doc.aspx?sourcedoc={dac0ebeb-b019-4578-911c-98.. Search (Option + Q) Review View Help Table O Editing er Av A =Define and compare the following types of nucleotide substitutions. Which is likely to cause the most dramatic mutant effect? a. missense mutation b. nonsense mutation c. sense mutation6. Refer to the figure answer the following questions. CLUSTAL W (1.83) multiple sequence alignment R-------WVDIALECERYLAPK 50 Human_AA Oyster AA Corn_AA -MKLFWLLFTIGFCWAQYSSN--TQQGRTSIVHLFEWR- -QVILWCLLYVGVVRGGTWSNPTCAPGRHTITHLFEWK-------WSDIAAECERFLGPM 52 MAKHLAAMCRCSLLVLVLLCLGSQLAQSQVLFQGFNWESWKKOGGWYNYLLGRVDDIAAT 60 : : : : *:*. Human AA Oyster AA Corn_AA GFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYV 110 GYCGVQISPPNENRIVTSPNRPWWERYQPVSYKLVTRSGNEADLRDMVQRCNKVNVRIYA 112 GATHVWLPPPSHSVAPQGYMPGRLYDLD---ASKYGTHAELKSLTAAFHAKGVKCVA 114 :: *.. ::: .:. : * Human_AA Oyster AA Corn_AA DAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDG-KCKTGSGDIENYNDA 169 DVVINHMTG-AGGSGTG-TGGSHWDGGSLSYPGVPFSSWDFNSGSECSTGDGNIHNYNDP 170 DVVINHRCA---DYKDGRGIYCVFEGG---TPDSRLDWGPDMICSDDTQYSN--GRG 163 :: Figure: Sequence alignment a) How many different species are used as the source of sequence in this analysis? I. two I. one III. threel IV. four b) What does the (*) mark mean in this alignment result? I.…Mutated DNA Sequence #2 T A C G A C C T T G G C G A C G A C T … What’s the mRNA sequence? (Circle the change) What will be the amino acid sequence? Will there likely be effects? What type of mutation is this? ________________________________Prove Me Wrong Assigned Statement Please post the statement that you were assigned below DNA mutations are always harmful. www. Provide Corrected Statement Provide a brief 1-2 sentence statement that would make above statement accurate Explain Corrected Statement Briefly explain: • Why the original statement was incorrect • How your change makes the statement correctPLEASE ANSWER ALL OF THEM. THEY ARE ALL CONNECTED MUTATION: Fill in the correct nucleotide base pairing and amino acid sequence of the mutated DNA. 1.. What is the 3’-5’ DNA sequence? (FORMAT: XXX-XXX-XXX-XXX-XXX) 2. What is the mRNA sequence? (FORMAT: XXX-XXX-XXX-XXX-XXX) 3. What is the tRNA sequence? (FORMAT: XXX-XXX-XXX-XXX-XXX) 4. What is the amino acid sequence? (FORMAT: XXX-XXX-XXX-XXX-XXX) 5. What is the most convincing type of mutation had occurred? (Frameshift resulting Missense; Frameshift resulting Nonsense; Substitution – Silent; Substitution – Missense; Substitution – Nonsense)| 四 ii D YouTube W Maps 6 viewbook-for-sim. Aid & Awards - Of.. O 2022-23_UAB_pa. W Student Z - McMa. Transfer your Gma. M MarkBook CON. (a) What type of mutation would be least harmful to an organism: silent, missense, or nonsense? Explain your answer. (b) What is the difference between gene mutations and chromosomal mutations? Paragraph В I. + v ... Lato (Recom... 19px... v 民 Add a File Record Audio Record Video MacBook ProRewrite the following sentences after correction. The variation in the length of tandem repeat of microsatellite DNA has serious translational affects as this is due to its coding region. Correct: If one parent has sickle cell anemia and other has carrier genotype than there is 25 % chance that any offspring is carrier. Correct: Sickled WBC block the flow of blood and Calcium as they stick together and caused by frame shift mutation. Correct: The N1303K mutation in the CFTR gene of CF patients is autosomal dominant disorder due to insertion of asparagine at 1303. Correct: If a person RBCs have B surface antigen and it will clump with antigen B such clumping indicates Blood type B. Correct: Indirect ELISA can detect polygenic gene expression. Correct:SEE MORE QUESTIONS