Why is derivatization (i.e., transesterification) of triglycerides or lipids to fatty acid methyl esters needed for the GC/MS experiment?
Q: The net ATP produced during a β-oxidation process is always less than two ATP because An ATP is…
A: Beta oxidation is a catabolic process by which fatty acid molecules are broken down in the…
Q: Using the restriction site for SalI, suggest another restriction enzyme that would cut at the same…
A: Isoschizomers are a set of enzymes that share the same recognition site in the restriction digestion…
Q: A sample of yeast extract has been analyzed of its invertase activity. The effect of temperature on…
A: Invertase is the enzyme that catalyze the hydrolysis of sucrose in fructose and glucose. Sucrose is…
Q: 14. Which of the following is a secondary amide? A. 요 B. NH₂ C. D.
A: Ans: INTRODUCTION The amide group is represented in structural formula by CONH2 .…
Q: H H-C=0 ATP H-C-OH HO-C-H V H-COH HOOH Hexokinase H-C-OHO meras-C-OHO kinase H OH H-C-O-P-O H o- HO…
A: Glycolysis is a metabolic pathway during which glucose molecule splits into pyruvate molecules with…
Q: a) b) Shown below is a DNA sequence that encodes for a section of a protein. Please write the amino…
A: In our body genetic information is stored in form of DNA. DNA multiples itself by replication. DNA…
Q: The textbook author admits the number of protons pumped from the matrix to inter-membrane space by…
A: Oxidative Phosphorylation: In a sequence of redox reactions, electrons are transferred from one…
Q: Our assay had two reactions, one catalyzed by glucose oxidase, and the second by peroxidase. What…
A: Enzyme kinetics assays (or simply Enzyme assays) are carried out to determine the kinetic parameters…
Q: Chemical mutagens often cause oxidation or deamination of DNA bases. This can lead to cancer by…
A: DNA damage is often caused by external sources like radiation exposure, exogenous chemical reactions…
Q: Graph a double reciprocal plot that satisfy the following: a. Michaelis-Menten kinetics enzyme,…
A: For a one-substrate enzyme-catalyzed reaction, the Michaelis-Menton equation shows the quantitative…
Q: The purpose of the progress curve is to determine if an enzymatic reaction rate remains constant for…
A: Progress curve is the measure of enzymatic velocity in a reaction. Velocity is given by the rate of…
Q: Which of the following is a ketone body? O Pyruvate Acetoacetic acid O Lactic acid O Glycogen
A: Ketone bodies contain ketone groups and are produced in the liver from fatty acids. The process of…
Q: How and where are ALT (alanine aminotransferase) and pancreatic amylase produced? What biochemical…
A: Alanine aminotransferase is an enzyme which is also called as serum glutamic pyruvic transaminase.(…
Q: *Write structures for the straight-chain (Fischer projection) formula and the indicated anomer of…
A: Carbohydrates are polyhydroxy aldehydes or ketones. They can be classified as monosaccharides,…
Q: The structures are tautomers of nucleotide bases. Identify each base. OH Base: OH ☆ Base: Base: "OH…
A: Nucleic acids are composed of nucleotides (sugar, nitrogenous base & phosphate group). Nucleic…
Q: The ff: table showed data of enzyme catalytic reaction. The rate of reaction (v) decreased with the…
A: Inhibitor constant (Ki ) is the equilibrium dissociation constant of the Enzyme-Inhibitor complex…
Q: During protein synthesis, which step does NOT require energy? dissociation of the 70S ribosome after…
A: The process of gene expression involves two steps: transcription and translation. Translation is the…
Q: The sequence of a peptide is given below. YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE If you perform peptide…
A: Proteins are composed of amino acids, which are bound together by peptide linkage. Amino acids…
Q: Questions: 1. What test tube will show positive starch hydrolysis and negative starch hydrolysis?…
A: Starch is a storage-type homopolysaccharide that contains two types of glucose polymers: amylose:…
Q: hormone-sensitive lipase that are needed for triacylglycerol mobilization is activated by:…
A: Hormone sensitive lipase are cytosolic proteins. They remain in inactive unphosphorylated form. In…
Q: what experiment can be used to confirm that agglutination was due to the binding of the lectins to…
A: Lectin is the collective name for all sugar-binding proteins. Lectins have one or more than one…
Q: 10) Determine bending rigidity of double stranded DNA molecule with persistence length of 45 nm (80%…
A: Deoxyribonucleic acid (DNA) is a double stranded polynucleotide coiled around a central axis to form…
Q: Explain IN DETAIL the process of glycolysis. Include the overall equation, location products,…
A: Introduction Glycolysis is a process by which glucose breaks down to produce pyruvate and energy.…
Q: Starch is an example of a O none of the other answers are correct O fat O carbohydrate O protein…
A: The four classes of biological macromolecules are proteins, nucleic acids, lipids and carbohydrates.…
Q: Provide 5 differences of HDL and LDL and explain each biochemically.
A: "Lipoproteins," a class of proteins, carry cholesterol through into the blood. Two different…
Q: Define vmax. How is vmax related to kcat?
A: The rate of a reaction can be monitored by various parameters. These are Km, Vmax, Kcat etc. Each of…
Q: An ion exchange resin prefers calcium over magnesium, indicated by Xcalcium = 0.6 and Ymagnesium =…
A: An ion-exchange resin or ion-exchange polymer is a insoluble resin or polymer that acts as a matrix…
Q: At a substrate concentration that is much greater than the KM for the reaction, which statement is…
A: The velocity of an enzyme catalyzed reaction is given by: V=Vmax×SKM+SWhere,V= velocity of the…
Q: 1. Oxidative phosphorylation and synthesis of ATP in mitochondria: • ways of ATP formation in cells…
A: Since you have asked multiple questions with multiple sub-parts, we will solve the first three…
Q: Lactate dehydrogenase (LDH): structure, characteristics, isoforms and their diagnostic significance.
A: Enzymes are bio-catalyst that participate in biochemical process and they are highly specific in…
Q: At pH 5, what is the net charge of the pentapeptide Val-Glu-Cys-Ser-Lys? O-1 O 0 O +1 O +2
A: The amino acids contain ionizable groups. The ionic form of theses ionizable groups depends on the…
Q: Signaling by tyrosine kinase receptors is generally associated with all of the following except: OA)…
A: A hormone is a class of signaling molecules in multicellular organisms that are sent to distant…
Q: a) What would be the effect on glycogen degradation if a mutation prevents the subunits of protein…
A: After a meal, there is a surplus supply of glucose in the blood. this causes the pancreas to secrete…
Q: A sample of yeast extract has been analyzed of its invertase activity. The effect of temperature on…
A: Invertase is the enzyme that catalyze the hydrolysis of sucrose in fructose and glucose. Sucrose is…
Q: Which of the following statements concerning complete protein hydrolysis is incorrect? Primary…
A: Protein hydrolysis is process of breaking down proteins into its components. Hydrolysis reactions…
Q: If the hydrolysis of 1 M glucose 6-phosphate catalyzed by glucose 6-phosphatase has a ΔG′∘ of…
A: In a general reaction such as: aA + bB ⇌ cC + dD At equilibrium (steady state), the concentration of…
Q: a) What is the overall function of pyruvate carboxylase? b) Describe the role of each of the four…
A: (a) A metabolic enzyme called pyruvate carboxylase takes part in the first stage of gluconeogenesis.…
Q: not all polypeptides form a secondary helical structure, explain why polypeptides containing ser,…
A: Two types of secondary structures are abundant in protein: alpha helix and beta sheets. The alpha…
Q: Determine whether each of the statements describes amyloid beta (AB) in Alzheimer's disease (AD),…
A: A protein's biological function depends on its three-dimensional structure. The 3D structure is…
Q: Phosphonacetyl-L-aspartate (PALA) is a potent inhibitor of aspartate transcarbamoylase because it…
A: Enzymes are biocatalysts that catalyse biochemical reactions. They contain an active site where the…
Q: 2. The Km of a particular enzyme is 2.0 x 105 M. If the initial velocity (Vo) is 0.16 mmol/min for…
A: For a one-substrate enzyme-catalyzed reaction, the Michaelis-Menton equation shows the quantitative…
Q: In an experiment to determine the degree of saturation in 0.43 g of an unknown lipid, the following…
A: The fatty acids in triglycerides can have one or more double bonds in the hydrocarbon chain. Fatty…
Q: 1. Draw the open-chain form for each of the following monosaccharides. CH OH HOOH НО CH₂OH OH OH он…
A: Monosaccharides Carbohydrates are polyhydroxy aldehydes or ketones. They can be classified as…
Q: Give the systematic name for the disaccharide shown in the image by selecting the appropriate terms.…
A: Conformation is the different positions a molecule can twist into. Configuration is the arrangement…
Q: Question 14 The first three amino acids in a protein are lysine, glutamine, and serine. T describes…
A: The four classes of biological macromolecules are proteins, nucleic acids, carbohydrates and lipids.…
Q: Enzymes work by... OA) Altering the equilibrium position of a reaction B) Altering the DG value for…
A: Enzymes are protein molecules that catalyze the biological reaction at mild conditions such as pH…
Q: If glucose labeled with 14C in C-1 is metabolized to ethanol and CO2 via fermentation, which carbon…
A: Pyruvate is the end product of glycolysis. Under anaerobic conditions it can have two possible…
Q: What are ketone bodies? How are they formed? What makes carboxylic acids acidic? Define the…
A: ketone bodies act as a source of energy under glucose and fat-deprived conditions. They are secreted…
Q: Which of the following is not a catabolic fate for pyruvate formed in glycolysis? fermentation to…
A: Pyruvate is the end-product of glycolysis. It is ultimately transported into the mitochondria and…
Q: What is the amount of sucrose hydrolyzed (in mg/mL) at optimum temperature ?
A: Enzymes are high molecular weight protein molecules that catalyse biochemical reactions. The…
Step by step
Solved in 2 steps
- What is the biological function of the Neurofibromin-1 (NF1) protein?CYP2E1 has a much higher Km for ethanol than ADH (11 mM versus 0.05 mM,respectively). When greater portions of ethanol are ingested (0.08% or 17 mM), which part of the statement would be true?Hemoglobin glycation (so named to distinguish it from glycosylation, which is the enzymatic transfer of glucose to a protein) is a non-enzymatic process that involves reaction of the N-terminal amino group of hemoglobin and glucose. The amount of glycated hemoglobin (GHB) is usually about 5% of total hemoglobin (and corresponds to a blood glucose concentration of 120 mg/100 mL). However, in people with untreated diabetes this value may be as high as 13%, which indicates an average blood level of about 300 mg/100 mL -dangerously high. One of the aims of insulin therapy is to maintain GHB values of about 7%. Draw a possible chemical scheme for the glycation of hemoglobin.
- The plasma profiles of codeine (COD) and metabolites for 2 individuals (labeled A and B) are shown below. The X-axis is time in hours after an oral dose of codeine. [M=morphine; C6G=COD-6-glucuronide; M3G = morphine-3-glucuronide; NM (ignore)]. Note the data is shown on a log scale on the Y-axis. (A) Which individual is the poor metabolizer? Explain how you know this from the profiles? (B) Is this a problem for cough suppression? Explain. -CH HO Codeine COD 10 000 1000 C6G COD 100 M3G M6G NM 10 M 10 20 30 0 10 20 30 Plasma concentration (nmol I-)Differentiate HbA1c from Fructosamine. Give 3 comparisonsThe brain is fueled almost exclusively by glucose. Using this fact, would it be a good idea to express glucose-1-phosphatase in muscle? What type of phenotype would be exhibited by a mouse expressing glucose-1-phosphatase in muscle?
- In McArdle's disease, a type of glycogen storage disease, there is a total deficiency of muscle glycogen phosphorylase. An individual with such disease is not able to exercise strenuously and experiences muscle cramps. Exercise leads to higher than normal levels of cellular ADP and Pi. Besides, lactic acid does not accumulate, as in the case of a normal individual. Explain the chemical imbalances shown in McArdle's discase.If a commercially available insulin preparation contains 1 ppm of proinsulin, how many micrograms of proinsulin would be contained in a 10-mL vial of insulin?Write schematically the synthesis of phosphatidylcholine from phosphatidylethanolamine. What compounds are necessary for this biochemical process? Biological significance of phospholipids.
- Refer to the figure below and answer the following questions: Legend: Blue – wild-type β-galactosidase; Red – mutant β-galactosidase _________ a. What is the optimum pH of wild type β-galactosidase? _________ b. What is the optimum temperature of mutant β-galactosidase? _________ c. Which enzyme has the greater activity at pH 7.2? _________ d. Which enzyme has the greater activity at a temperature of 42.5oC? _________ e. Which enzyme has greater activity if pH decreases from 7.5 to 6.4? _________ f. Which enzyme has greater activity if temperature increases from 40oC to 41 oC?Can you please help me how to draw tripeptide ile-leu-arg and indicate the torsion angles phi and psi for leucine?What is the effects of Inositol trisphosphate (IP3)?