Please help urgently with the complete answer of this question asap MRGSHHHHHHGSVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICMSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICNote these are incomplete sequences.Is there any purpose in the different amino acidsequence at the start (other than thepolyhistideine tag)? Why is the recombinantprotein amino acid 12 aa longer when the histidinetag is only 6 aa long?

Proteins are biomolecules are made of amino acid monomers. Amino acids are joined together by…

Answered: Please help urgently with the complete…

Science

Biochemistry

Please help urgently with the complete answer of this question asap

Biology: The Dynamic Science (MindTap Course List)

4th Edition

ISBN:9781305389892

Author:Peter J. Russell, Paul E. Hertz, Beverly McMillan

Publisher:Peter J. Russell, Paul E. Hertz, Beverly McMillan

Chapter19: Genomes And Proteomes

Section: Chapter Questions

Problem 1ITD: Below is a sequence of 540 bases from a genome. What information would you use to find the...

See similar textbooks

Related questions

Q: Can you help me answer this?

A: The term "homeostasis" refers to the body's continuous interior environment. Stasis = standing;…

Q: please help me in answering all even without explanation, thank you so much

A: Anabolic hormones are human growth hormone, insulin-like growth factor-1, insulin, and testosterone…

Q: Please answer situation 2. Thank you

A: IN situation 2 patient with bleeding at fracture site assess frist using following emergency…

Q: Mutualism

A: Mutualism is a type of positive interaction between the organisms. It is a symbiotic relationship…

Q: Please help urgently with this question please?

A: Actin is a globular protein that forms microfilaments, a type of cytoskeleton present inside most of…

Q: I need help on Questions 1 and 2 please.

A: 1. (a) Transduction is mediated by bacteriophage . Gene of a bacterium can be incorporated into…

Q: Could I have help with questions 1-5 please? I apologize if the picture is semi-blurry.

A: DNA is the nucleic acid present in the cells of eukaryotic cells.

Q: Medical assistance in dying

A: Medical assistance in dying means the care that is given in last days or hours of the patient. The…

Q: opic: Hodgkin’s Disease Question Discuss the role of the nurse in caring for the patient and…

A: In the body, the system that helps to get rid of waste and fight infections is found to be the…

Q: 40 41 please answer all

A: Biomolecules are the biological molecules that are present inside the living organisms. These…

Q: ncestral hordate

A: Chordates are divided into 3 subphyla: subphylum Craniata (fish, amphibians, reptiles, birds, and…

Q: Please ASAP. Thank you

A: From above questions Correct pairing of scientist and his contribution given below.

Q: Please advise

A: Appositional growth is the expansion of the cartilage matrix from within. It includes…

Q: Please answer ASAP Identify the WBC and briefly justify your answer.

A: Introduction : White blood cells (WBCs) are immune system cells. They aid in the fight against…

Q: Please help me with complete answer of this question within an hour????

A: The term used for the large mass of intertwining fungal hyphae is called Mycelium.

Q: Please answer all of these questions

A: Q. 10 . The correct option is B . Global warming . The temperature increases as there is increase…

Q: Please help me with this question. PLEase give me the right answer and for number 2 WRITE AT LEAST A…

A: Blood is the main circulating fluid in the human body. It is the fluid connective tissue. It is…

Q: Please answer all the questions 1-4 questions thank you so much!

A: Since you have asked multiple questions, we will solve only first question for you. If you want any…

Q: To whom should he speak regarding what currently occurs when an employee is ill or when there is a…

A: In an organization, two people play a major role, the employer and the employee. In any form of the…

Q: Please answer #13. I’m having trouble with it

A: Molecules can move across cell through a variety of different processes.

Q: help with these questions please

A: Lipids are molecules that contain hydrocarbons and make up the building blocks of the structure and…

Q: Just answer the items with no answer yet, thank you!

A: Maltose is a disaccharide composed of α-D-Glucose molecules, which are linked together through α…

Q: i need the answer quickl

A: The Nef (Negative Regulatory Factor) protein of the Human Immunodeficiency Virus-1 (HIV-1) was first…

Q: help Please answer all the questions I will give thumbs up

A: Fertilization is defined as fusion of male and female pronuclei to form a zygote. Fertilisation…

Q: I need to answer this question, Thank you

A: Ans: Potential energy

Q: Can I have help with question 3 please .

A: Introduction : By far the most significant risk factor for lung cancer is smoking. Approximately 80%…

Q: nswer

A: Breast cancer It is defined as malignant growth that begins from the epithelial lining of the breast…

Q: please help with both questions

A: Deoxyribonucleic (DNA) acid is a double helix structure, whereas RNA is a single-stranded both of…

Q: Could you please assist with this questions?

A: It is a single-stranded molecule consisting of nitrogenous base pairs like Cytosine, Uracil, Guanine…

Q: 7 8 please answer both

A: The biomolecules in the living organism perform different functions. Majority of the molecules in…

Q: I need help answering thus but in words I will understand.

A: In this question, we have to explain transport of glucose and sodium ion in words.

Q: need all of them answered, please

A: Leaf scars - Markings left when leaves fall Terminal bud scale scar - Circular structures at which…

Q: please help?

A: Sir Gregor Mendel was a priest and a teacher who did the famous hybridization experiment on garden…

Q: Hi can someone help me please. The picture contains the full structure.

A: Biomolecules are organic molecules that are mainly composed of carbon, hydrogen, oxygen, nitrogen,…

Q: Please do it quickly questions no 10

A: We know that Death due to blunt force trauma are one of the most common cases which is encountered…

Q: Please help me with this question urgently??

A: Lymphopoiesis: Lymphopoiesis (also known as lymphocytopoiesis) is the process of producing…

Q: NEED ANSWER ASAP PLEASE

A: Metabolic pathways are the combination of catabolic and anabolic reactions. Metabolic pathways…

Q: d correct answer.

A: As a nurse its her responsibility to remember the formula while calculating the drug to avoid…

Q: Explain well please

A: Carbohydrates production pathway. Gluconeogenesis is a pathway used by the body to create glucose…

Q: Please help me with this question at the earliest ???within an hour

A: BASIC INFORMATION ECOLOGY When the relationship between the organisms living on the earth and…

Q: Could you please assist

A: Epithelium is the type of animal tissue that lines the outer surface of several organs and blood…

Q: need answer asap

A: Inhibitors are substances that have the capability to inhibit enzyme activity by binding to the…

Q: er question 18

A: The process of research is fundamental for the acquisition of scientific and logical information. It…

Q: can i get help with this??

A: Transcription is the process by which the mRNA is synthesized from a DNA. During this process, one…

Q: I don't know what is that picture. I need help with the nameof label

A: The picture describes a cell undergoing a particular stage of Mitosis. A nucleus is visible with…

Q: receptor есе

A: Receptor Receptors are substances that helps in cell activation, cell adhesion and signaling…

Q: Hi there! Would you be able to assist with this question?

A: Mitosis is a type of cell division in which one cell divides to produce two daughter cells that are…

Q: Answer quickly please

A: Flagella is a long appendage or tail that provides swimming movement. It acts as a mobile device.…

Q: Please help me in the fraction part please and thank you!! ASAP!!

A: A dihybrid cross describes a mating experiment between two organisms that are identically hybrid for…

Q: PLEASE I NEED HELP WITH THESE QUESTIONS

A: 1. ECOLOGICAL RELATIONSHIP - In an ecosystem, what is known as an integration of all the living and…

Question

Please help urgently with the complete answer of this question asap

MRGSHHHHHHGSVSKGEELFTGVVPILVELDGDVN
GHKFSVSGEGEGDATYGKLTLKFIC
MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGD
ATYGKLTLKFIC
Note these are incomplete sequences.
Is there any purpose in the different amino acid
sequence at the start (other than the
polyhistideine tag)? Why is the recombinant
protein amino acid 12 aa longer when the histidine
tag is only 6 aa long?

Expert Solution

This question has been solved!

Explore an expertly crafted, step-by-step solution for a thorough understanding of key concepts.

SEE SOLUTION Check out a sample Q&A here

Step 1

VIEW

Step 2

VIEW

Step 3

VIEW

Step by step

Solved in 3 steps

SEE SOLUTION Check out a sample Q&A here

Knowledge Booster

Learn more about

Need a deep-dive on the concept behind this application? Look no further. Learn more about this topic, biochemistry and related others by exploring similar questions and additional content below.

Similar questions

In the following gel showing stained bands of the Alu insertion sequence, what is the genotype of individual 2? 941 bp 641 bp->>> 1 2 3 4 5 6 Homozygous for the 641 bp sequence that does not contain in the Alu insertion Heterozygous, containing one 941 bp sequence and one 641 bp sequence O Homozygous for the 941 bp sequence containing the Alu insertion
Compute the PERCENT IDENTITY for the following pairwise sequence alignment. ACTGATGGGGG--AGACGTA ||||| ... I ||||||| ACTG--AAAAGCTAGACGTA
based on the pictures How many base substitutions are there between these sequences? Count ONLY the instances where there is ANY nucleotide difference between any of the sequences (leave out any indels in this count) Are there any indels in this alignment? (yes or no)
What is the length in AA’s of the LilP protein? Assume fMet is NOT CLEAVED. Enter just the number, nothing else! Write out the sequence of the polypeptide in AA: use the three letter notation, e.g. Met-Ser-Pro- A lilP mutant called lilPXS is isolated that produces a truncated polypeptide of only 6 AA in length. Describe a single basepair DNA change that would lead to this truncated version of the protein. Multiple options are possible (100 words max.)
5’-GATCAGCTGACTGGATCCGTCCTCAACGTCAGGATCCAGCTTCAAG-3’ 1. How many cuts do you expect this enzyme to make on the above DNA and how many fragments do you expect to see on your gel? Assume that they are all different sizes.
For the following sequence, what is the Tm? 5'-AGCTACGATCAGGTCA-3'
For the following sequence please design an 18 base pair REVERSE primer. ATG TCA AAA GCT GTC GGT ATT GAT TTA GGT ACA ACA TAC TCG TGT GTT GCT CAC TTT GCT TAA
e. four-base, not overlapping4. An example of a portion of the T4 rIIB gene in whichCrick and Brenner had recombined one + and one −mutation is shown here. (The RNA-like strand of theDNA is shown.)wild type 5′ AAA AGT CCA TCA CTT AAT GCC 3′mutant 5′ AAA GTC CAT CAC TTA ATG GCC 3′a. Where are the + and − mutations in the mutant DNA?b. The double mutant produces wild-type plaques.What alterations in amino acids occurred in thisdouble mutant?c. How can you explain the fact that amino acids aredifferent in the double mutant than in the wild-typesequence, yet the phage has a wild-type phenotype?
Compute the percent identity of the following pairwise sequence alignment: -TGAGACTTAGAGT |..|... | | | | | ATAGGAGCGAGAGT
For the following sequence design the forward and reverse primer... explain and justify your answer. Gene of Interest: a tgaaacaaca aaaacggctt tacgcccgat tgctgacgct gttatttgcg 61 ctcatcttct tgctgcctca ttctgcagca gcggcggcaa atcttaatgg gacgctgatg 121 cagtattttg aatggtacat gcccaatgac ggccaacatt ggaagcgttt gcaaaacgac 181 tcggcatatt tggctgaaca cggtattact gccgtctgga ttcccccggc atataaggga 241 acgagccaag cggatgtggg ctacggtgct tacgaccttt atgatttagg ggagtttcat 301 caaaaaggga cggttcggac aaagtacggc acaaaaggag agctgcaatc tgcgatcaaa 361 agtcttcatt cccgcgacat taacgtttac ggggatgtgg tcatcaacca caaaggcggc 421 gctgatgcga ccgaagatgt aaccgcggtt gaagtcgatc ccgctgaccg caaccgcgta 481 atttcaggag aacacctaat taaagcctgg acacattttc attttccggg gcgcggcagc 541 acatacagcg attttaaatg gcattggtac cattttgacg gaaccgattg ggacgagtcc 601 cgaaagctga accgcatcta taagtttcaa ggaaaggctt gggattggga agtttccaat 661 gaaaacggca actatgatta tttgatgtat gccgacatcg attatgacca tcctgatgtc 721 gcagcagaaa ttaagagatg gggcacttgg tatgccaatg…
Below is a sequence of 540 bases from a genome. What information would you use to find the beginnings and ends of open reading frames? How many open reading frames can you find in this sequence? Which open reading frame is likely to represent a protein- coding sequence, and why? Which are probably not functioning protein-coding sequences, and why? Note: for simplicitys sake, analyze only this one strand of the DNA double helix, reading from left to right, so you will only be analyzing three of the six reading frames shown in Figure 19.4.
based on the picture What is the length in basepairs of these sequences? How many base substitutions are there between these sequences? Count ONLY the instances where there is ANY nucleotide difference between any of the sequences (leave out any indels in this count) Are there any indels in this alignment? (yes or no)