a Blue is dominant (B) to green (b) in a specific species of lizards. В b ВВ В Вь ВЬ What is the phenotype of the parent Bb? Blue b В Green В В с Heterozygous d Homozygous recessive
Q: Anaphase A. Is the phase during which sister chromatids separate and move to opposite poles b.…
A: Mitosis is the division of a diploid (2n) mother cell and production of two diploid (2n) and…
Q: pint intercept used to determine the abundance of a population? umple of the population is counted…
A:
Q: Which of the following types of mutations would be advantageous to a cancer cell (select all that…
A: Because negative regulatory proteins are eliminated when tumour suppressor genes are inactivated,…
Q: 1. Consider a cell with surface area 2.5 x 102 mm², initial water potential of -0.3MPa and membrane…
A: When the temperature and the pressure are held constant then the potential energy of the water to…
Q: What is the name of the DNA strand which copies the MRNA?
A: The DNA is genetic material in living organisms that is made up of two antiparallel polynucleotide…
Q: Briefly discuss the following topics and include appropriate examples for each: 1.1. Information…
A: All of the branches of the natural sciences that focus on different facets of life's processes are…
Q: Describe vocational issues for individuals with sickle cell anemia? How do bacteria and viruses…
A: 1- Anemia: Sickel cell break apart easily and die . RBC live usually for 120 days but sickel cell…
Q: Speculate why humans have evolved additional barriers to tumors compared to mice. What are some of…
A: For almost all animals, old age is associated with a common decline in tissue structure &…
Q: Methylated histone tail amino acids are associated with chromatin that is open only. closed only.…
A: The DNA is the genetic material in living organisms that remain associated with histone proteins in…
Q: 3. Complete the table by providing the important details about the 11 human organ system. What does…
A: Organs are composed of many tissues that together perform specific body functions. The interaction…
Q: True or False?? The descending pathway that inhibits pain stimulates inhibitory interneurons in the…
A: INTRODUCTION : Descending pain pathway - It is a reverse neuronal signal response for a pain…
Q: 7. Match the bases: Adenine, thymine, cytosine and guanine as found in DNA. 8. Which sugar is found…
A: Biomolecules are the most important organic compounds that are engaged in the upkeep and metabolic…
Q: When two molecules of glucose go through glycolysis, how many molecules of pyruvate are formed? a.…
A: Please follow step 2 for detailed explanation.
Q: At autopsy, it is revealed that the cause of death was strangulation. With respect to bones, what…
A: Hyoid bone is located close to the front part of our neck which is a tiny horseshoe or U shaped in…
Q: Distinguish between labile, stable, and permanent cells, and place each of the following…
A: Introduction The basic biological, structural, and functional components of all living things are…
Q: Match the proteins to their functions in DNA replication. DNA polymerase RNA polymerase Helicase…
A: Eukaryotic cells' nuclei and prokaryotic cells' nucleoid regions are where DNA replication takes…
Q: Problem: A bacteria can multiply at an alarming rate when bacterium splits into two new cells, then…
A: Bacteria divides at an alarming rate by binary fission that is one bacteria divides into two…
Q: The normal chromosome number of a spermatogonium in a male lynx is The Canada lynx has a diploid…
A: Chromosome are elongated thread like structure exhibited inside the nucleus of the cell. These…
Q: which of the following influences the bonding of oxygen to to hemoglobin? a) pH b) oxygen…
A: Hemoglobin molecule is the combination of a globin protein molecule and non-protein part heme and is…
Q: Rank these species in terms of their relatedness to crocodiles. Place the most closely related on…
A: Introduction : Phylogeny is the study of the organisms with respect to its evolution and the…
Q: Discuss in detail the inherited disorder in which affected individuals secrete abnormal body…
A: Cystic fibrosis is an autosomal recessive disorder, meaning that is not inherited solely from the…
Q: 1. Which of the following is true of a maternal effect? A) The gene is located in the nucleus. B) It…
A: Maternal effect produces when specific phenotypes of offspring are controlled by the factors that…
Q: QUESTION 13 Recall that the liver is responsible for making many of the proteins in plasma,…
A: Albumin: Liver synthesizes a wide variety of proteins and one among them is albumin. Albumin…
Q: Given the following, the sequence of urine flow in the urinary tract is: i. Renal papilla ii. Major…
A: Human beings have paired kidneys, which are present on the posterior wall of the abdomen.Normal…
Q: What is a function of the flower? a.) to develop into fruits which contains seed for reproduction…
A: Introduction The plant's reproductive organ is the flower. Since the beginning of time, flowers have…
Q: What amino acid does the codon AUG code for? OUAG-methionine (MET) UAC-methionine (MET)…
A: There are 64 possible codons, among them three do not code for any amino acid, known as stop codon.…
Q: Instructions: Put the following terms into a word map to explain how they are interrelated for DNA…
A: DNA replication is a complex process of producing copies of the entire chromosome using the…
Q: You have been hired by a major pharmaceutical company to develop a new vaccine to prevent COVID-19…
A: Virus comes from the Latin word venom which mean poisonous substance that may cause some serious…
Q: According to the following plant phylogeny, the following statements are true: fern pine star anise…
A: In phylogenetic trees, the relationships between taxa—groups of living things as well as the…
Q: The ribosome is unique to eukaryotic cells removes introns from RNAs catalyzes the formation of the…
A: Introduction : Ribosomes are known as protein factory, as they help in the synthesis of proteins.…
Q: 16. What is the relationship between an organism's DNA and protein? DNA determines which RNA…
A: Introduction Deoxyribonucleic acid is a polymer made of two polynucleotide chains that coil around…
Q: You like a wide variety of types of lettuce, so you plant many different varieties in your garden.…
A: The diversity refers to the different kind of variety of organisms present in an area. A wide…
Q: Explain the roles of cell signaling in DNA transcription and protein synthesis.
A: Introduction Cell signalling is the mechanism through which cells react to information. Cell…
Q: Below are six faces. Each face represents a species, with Species 6 being the outgroup. Seven…
A: Species is a group of organisms which can produce fertile offsprings by reproduction. When we…
Q: Explain any 5 non-communicable diseases clearly stating the predisposing factors, prevention and…
A: Noncommunicable diseases (NCDs), including heart disease, stroke, cancer, diabetes and chronic lung…
Q: 13. The following dilutions were performed to determine the concentration of bacteria in a culture.…
A:
Q: Which phenotypes can be said to be dominant?
A: Answer: Phenotype is the physical appearance of any living organisms, it can be either dominant or…
Q: Describing characteristic what gave homo habilis it's name
A: The extinct species of human known as Homo habilis, sometimes known as "able man" or "handyman," was…
Q: Species that have undergone higher rates of change (long-branched taxa) tend to be linked…
A: LBA (long branch attraction) is a type of error wherein the distinctly related species are shown as…
Q: NoCases 8000- 6000- 4000- 2000- 0- Apr 2020 Jul 2020 Oct 2020 DateRepConf Jan 2021 . Apr 202
A: The SARS-CoV-2 virus is the infectious disease known as coronavirus disease (COVID-19). The majority…
Q: Turtles, lizards, snakes, crocodiles, birds, and mammals are all amniotes whose offspring gestate…
A: Amniotic membrane as a derived character is shared by clade members. Reptiles and mammals are…
Q: Describe the physical barriers of the body that contribute to the immune defense system and…
A: The human body is constantly bombarded with foreign invaders, such as viruses, bacteria, and…
Q: The arm is known as the ________ region; the neck is known as the ________ region. a. otic; axillary…
A: We can say that The human body is complex machinery that is anatomically divided into three…
Q: Predict the effect on the target protein if a cyclin undergoes a mutation and is not broken down. O…
A: Mutation is an abrupt change in the DNA sequence which may change the amino acid sequence in a…
Q: This is an example of? a.) fibrous roots b.) tap roots c.) adventitious roots d.) prop roots
A: Fibrous roots are thin and heavily branched roots that arise from bottom of the plant stem.…
Q: Why do you think most bacteria grown in labs are mesophiles with a pH optimum for growth near 7.0,…
A: Mesophiles are a group of bacteria that grow well in the temperature of 20 degree Celcius to 45…
Q: Many invasion process models (including the framework in Blackburn et al. 2011) have emphasized that…
A: Invasion : Biological invasion is a process by which an organism introduced to and establishes a…
Q: Answer these questions in a You may include labeled drawings or tables, if helpful. Short answers,…
A: Countless trillions of chemical reactions take place daily in our bodies to support vital metabolic…
Q: LO18 Identify the components necessary for life Which of these components are NOT needed for the…
A: Answer: Life is the condition of biological processes in nature including growth, cell signalling,…
Q: 2. Imprinted genes: A) Provide an example of epigenetic inheritance. B) Often are near…
A: Epigenetic regulation of the genome is an absolute critical facet of organism's development. Gene…
Step by step
Solved in 3 steps
- Please help me with part one questions 3,4,5 Thank you PDF link https://www.cusd80.com/cms/lib/AZ01001175/Centricity/Domain/8922/eofad.pdfe.html?courseld=17594778&OpenVellum HMAC-977f3bf795c701a4bc0d750e73753852#10001 hesi book PubMed Google Scholar Citation Machine®:... S StuDocu - Free sum.... omework Activity: Figure 7.31 (1 of 2) Coccyx llium Pubis Sacrum Sacroiliac joint Hip bone (coxal bone) Pubic symphysis Ischium R 2019 Pearson Education in 5 Copyright © 2022 Pearson Education Inc. All rights reserved. | Terms of Use | Privacy Policy | Permissions | Contact Us | 6 & 7 P Pearson U 8 9 O ) 0 QL study room booking P PPrimary efecd al Increase the offmity of R NA pelymerase buding to a promrter, b) facilitate recombiraton doning ) Rovide prostectio.. agamst mtogratrien of lysogamic dl Generate of transposens? me iesis, ViYUses - mututions and chromosomal rearrargenments. el Conduct ONA reglication proofreadng àl Antibotics to freat infectons caused by facu Hontive bactenia athactve anaerabic homans, the teryets which would in be most shibiters of bacteriai are a) electon transgort. bl MRNA splicng ) hansciphion dl poly -A addion for MRNAS- e Nine of the abouer ) Which is a cheractenstic of eu Korgetic peten syntheni> polycistremic acid tans lated is formyl-methionme. a) {ukuryotic mRNA is bl The frst amino c) 'The MRNA most be polyadenglated atthe 3l end before trenslahion dl Er Karystia transcnphion e) Tansemphion and tenslation reguires single RNA polymenm Bccure duay as t t ig) If the alkle cousing sickle cell i> present at a amemia fres wancy of o.05 certain lorge, rendomly-mating in…
- Three polypeptides, the sequences of which are represented below using the one-letter code for their amino acids, are present in a mixture:1. ATKNRASCLVPKHGALMFWRHKQLVSDPILQKRQHILVCRNAAG2. GPYFGDEPLDVHDEPEEG3. PHLLSAWKGMEGVGKSQSFAALIVILAOf the three, which one would migrate most slowly during chromatography through:(a) an ion-exchange resin, beads coated with positively charged groups?(b) an ion-exchange resin, beads coated with negatively charged groups?(c) a size-exclusion (gel-filtration) column designed to separate small peptides such as these?(d) Which peptide contains the ATP-binding motif shown in the following sequence logo?Bruce Ames and his colleagues have pointed out that although detailed toxicological analysis has been conducted on synthetic chemicals, almost no information is available about the mutagenic or carcinogenic effects of the toxins produced by plants as a natural defense against fungi, insects, and animal predators. Tens of thousands of such compounds have been discovered, and he estimates that in the United States adults eat about 1.5 g of these compounds each daylevels that are approximately 10,000 times higher than those of the synthetic pesticides present in the diet. For example, cabbage contains 49 natural pesticides and metabolites, and only a few of these have been tested for their carcinogenic and mutagenic effects. a. With the introduction of new foods into the U.S. diet over the last 200 years (mangoes, kiwi fruit, tomatoes, and so forth), has there been enough time for humans to develop resistance to the mutagenic effects of the toxins present in those foods? b. The natural pesticides present in plants constitute more than 99% of the toxins we eat. Should diet planning, especially for vegetarians, take into account the doses of toxins present in the diet?BL1250 Group activity 4 2020 (1) – Saved to my Mac v Mailings Review View Tell me EXERCISE 4 QUESTIONS 1. TRANSCRIPTION: Much research effort has been invested in understanding how transcription is regulated, because this process is very important for determining cell function. Transcription is a major on/ off switch for genes, providing the instructions for translation and determining the types and amounts of proteins made in a cell at a specific time. The Zebrafish is a model organism for research, and many biologists study how the regulation of genes affects the development of the zebrafish embryo. The effects of a variety of experimental conditions on zebrafish embryos can be easily visualized by light microscopy, because the outer covering (chorion) and the embryo are both transparent. See an images of zebrafish embryos at different time points in development and the adult form below. 0h Os 0.75 h 2h 3.25 h 8 h 16 h 24 h 72 h Adult -3 months (not to scale) Image from:…
- Please help me with part one question 3 Thank you PDF link https://www.cusd80.com/cms/lib/AZ01001175/Centricity/Domain/8922/eofad.pdfA 30 - year - old woman was undergoing therapy for b-thalassemia,a recessive trait caused by absence of or reduced synthesis ofthe hemoglobin b chain, a subunit of the oxygen-carrying moleculein red blood cells. In this condition, red blood cells are rapidlydestroyed, freeing a large amount of iron, which is deposited in tissuesand organs. The blood transfusions the patient had received every twoor three weeks since the age of 7 to stave off anemia were furtheraggravating iron buildup. Her major organs were showing damage, andshe was in danger of death from cardiac disease. Her physician suggestedthat she consider undergoing a hematopoietic (bone marrow)stem cell transplant (HSCT). Since these stem cells give rise to redblood cells, such a transplant could potentially restore her health. Whilethis might seem like an easy decision, it is not. Advanced cases havea high risk (almost 30 percent) for transplantation-related death. At thispoint, the woman is faced with a difficult and…A 30 - year - old woman was undergoing therapy for b-thalassemia,a recessive trait caused by absence of or reduced synthesis ofthe hemoglobin b chain, a subunit of the oxygen-carrying moleculein red blood cells. In this condition, red blood cells are rapidlydestroyed, freeing a large amount of iron, which is deposited in tissuesand organs. The blood transfusions the patient had received every twoor three weeks since the age of 7 to stave off anemia were furtheraggravating iron buildup. Her major organs were showing damage, andshe was in danger of death from cardiac disease. Her physician suggestedthat she consider undergoing a hematopoietic (bone marrow)stem cell transplant (HSCT). Since these stem cells give rise to redblood cells, such a transplant could potentially restore her health. Whilethis might seem like an easy decision, it is not. Advanced cases havea high risk (almost 30 percent) for transplantation-related death. At thispoint, the woman is faced with a difficult and…
- What is the type of geneticinheritance of daltonism? Isdaltonism more frequent inmen or in women? What is thephysiological explanation forthe daltonism?10- 00 O SCNSA-SCN10A CDKN1A HANDI VTI1A SYTI • MYOCD 9 10 11 12 13 14 15 16 17 18 19 20 2122 X Yem 92 of 145 Z 92. During an experiment, a researcher inactivates the fibroblast growth factor receptor gene expressed on grandiosa celih Which of the folog A) Absence of androgen production B) Formation of tumors from thecal cells C) Inhibition of formation of the follicular antrum D) Premature ovulation E) Transformation of thecal cells into granulosa cells