22. Below is a DNA double helix coding for a very small polypride. Nontemplate Strand 5' TTTTATGCGCCCCAGTAAGTAATGACTA 3' AAAATACGCGGGGTCATTCATTACTGAT-Template Strand 5' 3' a. What is the direction of synthesis for the mRNA? b. Draw the m-RNA that would be transcribed (labeling the 5' and 3' ends) and circle the initiator codon. c. Which end of the mRNA is transcribed first? d. Using the genetic code table, list the amino acid sequence resulting from this mRNA.
Q: Is hCG produced by the mom?
A: It is a hormone produced by the placenta.
Q: Intro to Neuroscience College Describe the papez circuit at the college level of an introduction to…
A: One of the key concepts you’ll encounter is the Papez circuit. This neural circuit, proposed by…
Q: Identify the 3 different Taste buds below:
A: Our capacity to see and interact with the world around us is made conceivable by the assortment of…
Q: ) What does these results mean as shown in the three graphs and t-tests? 2) Can you explain why…
A: 1) In analyzing thе rеsults, it is еvidеnt from Graph 3 dеpicting lеaf counts that thе control group…
Q: Is this a microbial formation visible to the naked eye? Explain. Leg abscess aspirate swabbed onto…
A: Microbes are biological entities that can not be seen by the naked eyes due to their very small…
Q: What are the steps in sandwich ELISA? Explain and provide a schemiatic diagram
A: Enzyme immunoassay (EIA) and enzyme-linked immunosorbent assay (ELISA) are both widely used as…
Q: consider Smallpox, Polio, Ebola and Measles Label each of the SIR curves below with the correct…
A: Thе SIR (Suscеptiblе-Infеctious-Rеmovеd) curvеs providеd dеpict thе tеmporal dynamics of infеctious…
Q: What do you think are its potential benefits of optogenetics to treat bipolar disorder? What…
A: Optogenetics is a biological approach that uses light to regulate the functioning of neurons or…
Q: Capsule C. Spleen While pulp Red polp White pulp Red pulp Trabecula Capsule Central artery…
A: The spleen is an important organ on the left side of the abdomen that filters blood, removes damaged…
Q: The majority of GWAS associated variants exist in non-coding regions. This has led to additional…
A: Two non-coding mechanisms that contribute to genetic variation and may be associated with non-coding…
Q: Use the diagram below to answer the following questions. III IV NU V₁ Amount of DNA in nucleus I II…
A: Cell cycle refers to a series of events that takes place in a cell during its growth and division.In…
Q: A 69-year-old woman presents with crushing substernal chest pain and nausea. Laboratory studies show…
A: The objective of the question is to identify the pathological changes evident in the autopsy…
Q: The immune system can be split into two major categories, the innate immune system and the adaptive…
A: To protect the body from dangerous invaders like bacteria, viruses, fungi, and parasites, the immune…
Q: What is not found in a prokaryotic mRNA transcript? Stop codons AUG codons multiple adenines in the…
A: The question is asking us to identify which of the listed elements is not found in a prokaryotic…
Q: A hypothesized evolutionary advantage to asexual reproduction in fungi is that: -It allows them to…
A: Fungi are any eukaryotic creatures that include microbes like molds and yeasts, along with the more…
Q: what is the mode of action of abamectin in insects?
A: Abamectin is an insecticide and acaricide derived from the bacterium Streptomyces avermitilis. It…
Q: immune system
A: An organ believed to contribute to immune system functions by preserving a reserve of beneficial…
Q: 1. Create a Punnett square showing the genotypes of the offspring for a homozygous dominant purple…
A: The alleles of each parent and their potential combinations in the progeny are represented in a…
Q: Researchers tend to favor small lipophilic molecules when designing new therapeutic drugs. Which of…
A: Lipids or fats are the preferred solvents for lipophilic molecules, sometimes referred to as…
Q: Why is mouse spleen organn pressed and passed through a cell strainer in splenoyte preparation?
A: Splenocytes are vital for immunology research because they are easily isolated and used in a wide…
Q: Describe the molecular mechanisms of hippocampal LTD at the introduction level (Introduction to…
A: A cellular mechanism for learning and memory, long-term potentiation (LTP) is the steady…
Q: With the aid of diagrams, discuss the role of autoantibodies in three named autoimmune diseases,…
A: Autoimmune diseases are characterized by the immune system mistakenly attacking healthy tissues and…
Q: Which of the following is the most serious type of mutation? -Nonsense -Missense -Silent -They all…
A: Mutations are alterations in the DNA sequence that can result in changes to the encoded protein,…
Q: Distinguish between the pyramidal and extrapyramidal motor pathways at the introduction level…
A: The pyramidal pathway, also referred to as the corticospinal or corticobulbar tract, is in charge of…
Q: What is meant by 'free water molecules" in relationship to the movement of water between a…
A: Osmosis, the movement of water across a semipermeable membrane, plays a crucial role in various…
Q: 20. Which pair is an example of antagonistic hormones? a. Estrogen and Testosterone b. Epinephrine…
A: Hormones are specific chemical messengers that are produced and released from the endocrine glands…
Q: Q1: Explain the differences between different types of graded potentials? Also, Categorize 4 major…
A: Graded potentials are changes in the membrane potential of a neuron that can vary in magnitude. They…
Q: Which of the following is NOT a criteria to be classified as a mineral? Anthropogenic (manmade or…
A: Minerals are natural substances that occur naturally in the Earth's crust.These minerals are…
Q: Let's continue with these two genes that control the color and texture of tomatoes. Allele "R"…
A: The objective of this question is to determine the probability of obtaining a red tomato with a…
Q: Without these, the Earth would freeze; however, an excess of these created by such factors as…
A: The question is referring to greenhouse gases. Greenhouse gases are gases in Earth's atmosphere that…
Q: The Calvin cycle (light-independent reaction) occurs in the Matrix Xylem Cristae membrane Stroma…
A: The Calvin Cycle, also known as the Calvin-Benson cycle or the dark reactions, is a series of…
Q: PCR and DNA Fingerprinting 9. An RNA molecule has the following percentages of bases: A = 23%; U =…
A: Chargaff's Rule, formulated by biochemist Erwin Chargaff, states that in a DNA molecule, the amount…
Q: 1 point Later on, you made a completely new cross. But you cannot remember the genotype from one of…
A: The objective of this question is to determine the genotype of the unknown parent in a genetic…
Q: what is exercise? write an evaluation of your physical activity level. How much are you exercising…
A: In this context, investigating individual exercise propensities, comparing them to prescribed rules…
Q: The Nutrition Facts label on most food products shows % daily values based on a food energy…
A: The sophisticated process of turning food energy into ATP (adenosine triphosphate), that operates as…
Q: Several factors (e.g., time and voltage) affect migration of DNA fragments through the agarose gel.…
A: A DNA fragment is a segment of DNA that has been cleaved or cut from a longer DNA molecule. DNA…
Q: During your experiment you analysed only a few of the recombinant clones for the presence of…
A: Genomics is the scientific investigation of an organism's complete or partial genetic or epigenetic…
Q: Select statements that accurately describe receptor tyrosine kinases (RTKs). Some RTKs are dimeric…
A: Receptor Tyrosine Kinases (RTKs) are a family of cell surface receptors that play a crucial role in…
Q: Introduction to Neuroscience College Level). Describe the synaptic and molecular mechanisms of…
A: A cellular mechanism for learning and memory, long-term potentiation (LTP) is the steady…
Q: For the following problem, indicate whether enzyme is repressed (-) or produced (+). Please show all…
A: The lac operon is a set of genes that are used in the metabolism of lactose in E. coli. The operon…
Q: Cholera toxin has which of the following direct or indirect actions: a. opens Na+ channels; Choose…
A: S.N. De discovered cholera toxin (CT) just over half a century ago. We've gone a long way since this…
Q: Which of the following classes of vertebrates demonstrates behavioral thermoregulation? --all…
A: Vertebrates, a diverse group of animals with backbones, possess an intricate mechanism known as…
Q: If a vaccination initiative requires two nurses to perform vacinations but the hospital has staffing…
A: The objective of the question is to understand how a manager can build support and sustain a…
Q: What is the endocrine system? What is it for? What is the lymphatic system? What is the main…
A: The human body is a complex organism made up of various systems, each with specific functions and…
Q: Two pure-breeding lines of petunia plants are crossed. Line 1 plants grow to a height of 54 cm, and…
A: Two pure-breeding lines of petunia plants are crossed.Line 1 plants grow to a height of 54 cm, and…
Q: Which of the following mammals has the highest metabolism (measure in kcal/hour used) of those…
A: Basal metabolic rate (BMR) is the minimum amount of energy your body needs to function while you are…
Q: Which of the following does not stimulate acid secretion? Group of answer choices Somatostatin…
A: A vital step in the digestion process is the secretion of gastric acid, which enables the stomach to…
Q: What is the BMR per square meter of the surface area for the mouse? ______ kcal/d/m2
A: Given Data:AnimalBMR (kcal/d)Mass (kg)Surface Area…
Q: are
A: Microbial cells are tiny, single-celled organisms such as bacteria, archaea, fungi, and protists.…
Q: Describe the molecular interactions that a cell uses to migrate through extracellular matrix. (use…
A: The objective of the question is to understand the molecular interactions that a cell uses to…
Step by step
Solved in 3 steps
- www D le C 3⁰ A B Indicate True (T) or False (F) for the following statements. Only use the letter (T/F) in the space provided 1. The name of this process is best known as Rho dependent termination 2. The enzyme C called DNA polymerase incorporates ribonucleotides into B called the mRNA False 3. The DNA region A contains inverted palindrome sequences which results in formation of a stem-loops structure 4. During this process, the structure D called terminating hairpin forms and increases the enzyme affinity which terminates transcriptionCynt Classifying mutations A certain section of the coding (sense) strand of some DNA looks like this: $-ATGTATATCTCCAGTTAG-3" It's known that a very small gene is contained in this section. Classify each of the possible mutations of this DNA shown in the table below. mutant DNA 5- ATGTATCATCTCCAGTTAG-3' S-ATGTATATCTCCAGTTAG-3 5- ATGTATATATCCAGTTAG-3' type of mutation (check all that apply) insertion deletion point silent noisy insertion O deletion point silent noisy insertion O deletion point silent Onoisy X GQUESTION: Transcribe the gene. Write out the correct sequence of m RNA bases. Notice that this is the same gene as in B above. Recall that in RNA, thymine (T) does not exist and uracil (U) takes its place. 3' ССА TAG CÁC CTT GTC ACA ACG TGT TCG TAG ACA 1 3. 4. 6. 7. 8. 9- 10 11 AGG AAC АТА ATA GTT AAC CTT TTG ATA ACA ТТА ACT 12 13 14 15 16 17 18 19 20 | 21 in
- First Letter A G U с 22. Using the provided "Genetic Code-Reference" answer the following question. Based on the following DNA template strand, write out the amino acid chain produced. 23. Consider the following mRNA base codon sequence 5'-AUC-GAA-3' and the provided "Genetic Code-Reference". Genetic Code-Reference UUU UUC UUA UUG CUU CUC CUA CUG (mutated or silent) (mutated or silent) b. Briefly explain your reasoning for each. (be sure to include both parts) AULLY AUU a. Label which of the following would result in a mutated amino acid sequence or a silent mutation. (May help to first determine the original amino acid sequence, then compare to mutations) U Phe mRNA codon sequence: anticodon sequence: amino acid sequence: Leu Leu 5'-AUA-GAA-3' Val 5'- AUC-GAC-3' AUC Ille AUA AUAJ *AUG Met/Start GUU GUC GUA GUG UCU UCC UCA UCG) CCU) CCC ccc CCA 000 CCG ACU ACU ACC ACA ACG, C GCU GCC GCA GCG Second Letter Ser Pro Thr 3'-CAA-GTC-TGT-5' Ala UAU UAC) Tyr Туг A **UAA Stop UAG Stop CAU] CACJ…pcc300ATAAADATATAOOTTAA 1. Use the genetic code table and the information in the diagram below to determine the amino acids that would make up the portion of the polypeptide shown. Include information for a key as well. DNA template 3' G CATA ACAGAGGATT-5' al bnsua AMAm pniwollot erfT E transcription s yd bnsita ebitgeqylog s sidmeaze of beae RNA strandUU UAOUOUU A-emoaodin 5'-CGUA AUUGUC UCCUUA- 3' J J JL erit o elinW (s) translation bluow terdt aspnso sigootiwsone polypeptide viemetis ns ebivo19 (d) ent ot etslanT Key:Format Tools Add-ons Help Last edit was seconds ago Arial BIUA Normal text 11 1 3 Which of the following molecules|are involved in gene expression? Choose all that apply. O RNA polymerase O Splicing O Primer O Origin O Stop codon O Start codon O Parental strand O IRNA O Okazaki fragment O Bubble OFork O Leading strand O Helicase O DNA polymerase OA site O Amino acid attachment site O Primase O Primer O Terminator sequence MAY 18 étv A MacBook Air
- III. Deletion of C IV. Both I & II 6. Refer to the figure answer the following questions. CLUSTAL W (1.83) multiple sequence alignment Human_AA Oyster AA Corn_AA -MKLEWLLFTIGFCWAQYSSN--TOOGRTSIVHLFEWR-------WVDIALECERYLAPK 50 -QVILNCLLYVvGVVRGGTWSNPTCAPGRHTITHLFEWK- -WSDIAAECERFLGPM 52 MAKHLAAMCRCSLLVLVLLCLGSQLAQSOVLFOGFNWESWKKOGGWYNYLLGRVDDIAAT 60 : : : : *:*. %3: .. O Human_AA Oyster AA Corn AA GFGGVOVSPPNENVAIHNPFRPWWERYOPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYV 110 GYCGVOISPPNENRIVTSPNRFWWERYOPVSYKLVTRSGNEADLRDMVQRCNKVNVRIYA 112 GATHVWLPPPSHSVAPOGYMPGRLYDLD------ASKYGTHAELKSLTAAFHAKGVKCVA 114 ::*.. : ::.:. :.*: Human_AA Oyster AA Corn AA DAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDG-KCKTGSGDIENYNDA 169 DVVINHMTG-AGGSGTG-TGGSHWDGGSLSYPGVPFSSWDFNSGSECSTGDGNIHNYNDP 170 DVVINHRCA---DYKDGRGIYCVFEGG------TPDSRLDWGPDMICSDDTQYSN--GRG 163 :: * ***** Figure: Sequence alignment a) How many different species are used as the source of sequence in this analysis? I. two I. one II. three IV. four b) What…RNA is transcribed. Label the 5′ and 3′ ends of each strand. 17. The following sequence of nucleotides is found in a single-stranded DNA template: ATTGCCAGATCATCCCAATAGAT Assume that RNA polymerase proceeds along this template from left to right. a. Which end of the DNA template is 5′ and which end is 3′? b. Give the sequence and identify the 5′ and 3′ ends of the RNA transcribed from this template.Third letter UCAG UCAGH CAC First letter Part 5: Coding Practice 1. Use this sequence of DNA to answer the following former test questions: 5'-- TTAATGGGACAGCTTGTGTAGAGG --3' a. What is the complementary strand of DNA? b. Using the complementary strand of DNA (your answer from part a) as the template strand, what is the transcribed mRNA sequence? C. What is the amino acid sequence translated from the strand of mRNA synthesized in part b (use the genetic code below)? Remember: i. Start codon! ii. Stop codon! bac ocent Seond letter UUU Phe UAU Tyr UGU UGC Cys UUC UCC UAC Ser UAA Stop UGA Stop A UAG Stop UGG Trp G C. UUA UCA UUG Le UCG [ CAU ] CAC CUU CGU His CUC C CGC ne. CCA Arg Pro CUA CAA CGA CCG CAG Gin CGG CUG AAU 1 AAC Asn ACU AGU [ [ AUU AUC Ile AGC Ser Thr A AUA AGA AGG ACA AAA Arg AUG Met ACG AAG GUU GCU GAU GGU Asp GAC GCC GGC GUC Val G GUA GCA Ala GAA GGA Gly GAG Glu GGG GUG GCG
- BM4_DNA AND PROTEIN S X /1FAIPQLSDP_g5B-629FSHNpGnTMIEppLS4A71zBd4vcUBqNUILubXONw/formResponse 4. What is the nitrogen base pair of Adenine in transcription? O Cytosine O Uracil O guanine O thymine 5. The central dogma of Molecular Biology states that There are four nitrogen bases in DNA, two purines (adenine and guanine) and two pyrimidines (cytosine and thymine). Which process is not included in the central dogma? duplication transcription translation O translocation LeadpleRNA Transcription, Translation, and Mutation Worksheet First, here is a strand of DNA. This strand contains both a gene and its promoter region. Circle the promoter region in blue, draw a yellow box around the TATA box, draw a green box around the start codon, and draw a red box around the stop codon: TATATATATTACGTTGCATACGCTCAACGGTCGAAACTGCATGGGCAC ATATATATAATGCAACGTATGCGAGTTGCCAGCTTTGACGTACCCG Now imagine this gene has been transcribed into RNA. What would that RNA strand look like? Before the above RNA strand can be translated, a few modifications must first take place (in eukaryotes). What are they? 1) 2) 3) Using a codon chart of your choice (one can be found here, or here) translate the above RNA transcript (assume no splicing took place). Write the three letter abbreviations for the amino acids in the image below: Now imagine that a mutation took place in the original strand of DNA (marked in red) TATATATATTACGTTGCATACCCTCAACGGTCGAAACTGCATG…Row A B. C D Process 1 transcription transcription translation Protein Synthesis in an Animal Cell Select the row below that correctly identifies the name of Process 1 as well as a sequence that could represent Structure 1. Sequence of Structure 1 CGA ATT GTA CAA CGA AUU GUA CAA CGA ATT GTA CAA CGA AUU GUA CAA translation Structure 1 Process 1 Structure 2 ORA Process 2